Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWS------GNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSVCDPGRGQP-------YVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGS---------------LFPVIFSSMEYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSL-GPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLAE-----------------------------------------
2YIN Chain:A ((1196-1620))SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR


General information:
TITO was launched using:
RESULT:

Template: 2YIN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -63511 for 1808 contacts (-35.1/contact) +
2D Compatibility (PS) -28759 + (NN) -33 + (LL) 0
1D Compatibility (HY) -800 + (ID) 1350
Total energy: -94453.0 ( -52.24 by residue)
QMean score : -0.052

(partial model without unconserved sides chains):
PDB file : Tito_2YIN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2YIN-query.scw
PDB file : Tito_Scwrl_2YIN.pdb: