Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK
4JH7 Chain:A ((1-138))MLNGINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKPHMTFY-


General information:
TITO was launched using:
RESULT:

Template: 4JH7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -62458 for 861 contacts (-72.5/contact) +
2D Compatibility (PS) -14578 + (NN) -2285 + (LL) 64
1D Compatibility (HY) -17600 + (ID) 4350
Total energy: -101207.0 ( -117.55 by residue)
QMean score : 0.443

(partial model without unconserved sides chains):
PDB file : Tito_4JH7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4JH7-query.scw
PDB file : Tito_Scwrl_4JH7.pdb: