Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKIAVFASANGSNFQVIAE-----QFP--VSFVFSDHRDAYVLERAQNLAIPSFAFELKEFENKAAYEQAVVDLLDKHEIDLVCLAGYMKIVGETLLSAYEGRIINIHPTYLPEFPGAHGIKDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVHVPRLADDSLESFETRIHETEYQLYPAVLDSLGIKRK
3AUF Chain:A ((2-179))IRIGVLISGSGTNLQAILDGCREGRIPGRVAVVISDRADAYGLERARRAGVDALHMDPAAYPSRTAFDAALAERLQAYGVDLVCLAGYMRLVRGPMLTAFPNRILNIHPSLLPAFPGLEAQRQALEHGVKVAGCTVHFVTAGVDEGPIILQAAVPVLEGDTVEDLRRRILAEEHRIYPEAIRLFAEGRL


General information:
TITO was launched using:
RESULT:

Template: 3AUF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -131858 for 1371 contacts (-96.2/contact) +
2D Compatibility (PS) -19021 + (NN) -11104 + (LL) 0
1D Compatibility (HY) -18000 + (ID) 3450
Total energy: -183433.0 ( -133.80 by residue)
QMean score : 0.548

(partial model without unconserved sides chains):
PDB file : Tito_3AUF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3AUF-query.scw
PDB file : Tito_Scwrl_3AUF.pdb: