Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIPVVSSGRTDSGVHAAGQVIHFDTPLSIPAERWPYALNALLPDDIAVKQAEIADDGFHARFSAVKKEYRYFVYTEK-HPDVFKRHYAYHFSYRLNVQDMREAAKHLIGTHDFTSFCAAKTEVQDKVRTIYELDWTETADGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDEVKSMLEAKDREAAGRTAPGHGLYLWNVYYDN
2NR0 Chain:A ((11-254))-KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQV--ANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVT-HFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPD


General information:
TITO was launched using:
RESULT:

Template: 2NR0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -150777 for 1986 contacts (-75.9/contact) +
2D Compatibility (PS) -26283 + (NN) -14378 + (LL) 408
1D Compatibility (HY) -18800 + (ID) 4600
Total energy: -214430.0 ( -107.97 by residue)
QMean score : 0.401

(partial model without unconserved sides chains):
PDB file : Tito_2NR0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2NR0-query.scw
PDB file : Tito_Scwrl_2NR0.pdb: