Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ 1XMI Chain:A ((240-284)) --------YGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLRRFSL-----

General information: TITO was launched using: RESULT: Template: 1XMI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 32 -2090 -65.30 -46.43 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -65.30 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.019

(partial model without unconserved sides chains): PDB file : Tito_1XMI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1XMI-query.scw PDB file : Tito_Scwrl_1XMI.pdb: