Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNLNFIVPDINMTFGDMKFMGLNRERYVYDRENNKRTDVLESRIY--NIAS--AVQGGQIEVTIPEYAGAKEIPPFADIELKNPKISAMATSQRDSTYANVMWKLEADDIVVKGGSSVKPAAATGGNEKK 1KER Chain:A ((11-73)) --------------GGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLA-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1KER.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 190 -8218 -43.25 -139.29 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -43.25 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.112

(partial model without unconserved sides chains): PDB file : Tito_1KER.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KER-query.scw PDB file : Tito_Scwrl_1KER.pdb: