Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT 1IFC Chain:A ((3-31)) ----------------DGTWKVDRNENYEKFMEKMGINVVKRKLG---------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1IFC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 34 -3234 -95.12 -111.52 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.38 3D Compatibility (PKB) : -95.12 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.38 QMean score : -0.080

(partial model without unconserved sides chains): PDB file : Tito_1IFC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IFC-query.scw PDB file : Tito_Scwrl_1IFC.pdb: