Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSYKVIELANKYSAAAEEVRSSKMLLESRLSALGDAWQGKARDSFDQDFEETKAAYDQFEQELLETSQELKAAAVKIEERKAEIARMEELERKAREERHKLGR 3ZBH Chain:A ((17-94)) --------VARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIA------------------

General information: TITO was launched using: RESULT: Template: 3ZBH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 111 -4472 -40.28 -57.33 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -40.28 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.675

(partial model without unconserved sides chains): PDB file : Tito_3ZBH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZBH-query.scw PDB file : Tito_Scwrl_3ZBH.pdb: