Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAVNFYDVAYDLENALRGSEEFTRLKNLYDEVNADESAKRMFENFRDVQLRLQQKQMAGEEITQEEVTQAQKTVALVQQHEKISQLMEAEQRMSMLIGELNKIIMKPLEELYGSVEG 1GNY Chain:A ((92-146)) -------------DCLAGSSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVT-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1GNY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 70 -6802 -97.16 -123.66 target 2D structure prediction score : 0.05 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -97.16 2D Compatibility (Sec. Struct. Predict.) : 0.05 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_1GNY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1GNY-query.scw PDB file : Tito_Scwrl_1GNY.pdb: