Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKKETAWMKRKQLLYTEERKWEYGTILIEDGICLIENGEGDILLADSLQHSPIWIHHKGKWEQAGFQDKLVLACGAENISLSGGERIRYEKSVKRPLMALLDSLDDETFLAFLQHLHSFGLSVFDCVFSYNKGVFSNTSAGQGVSFYHFSNDTAQCAMQHHYNYSSEG----TGDRF-EWTASNGKRSIMYTAVQRGRK 1W3H Chain:A ((11-86)) ------------------------------------------------------------------------------------------------------------S--PGLASLADFPIGVAVAASGGNADIFT-SSARQNIVRAEFNQITAENIMKMSYMYSGSNFSFTNSDRLVSWAAQNGQ-------------

General information: TITO was launched using: RESULT: Template: 1W3H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 219 -18776 -85.73 -264.44 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -85.73 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.044

(partial model without unconserved sides chains): PDB file : Tito_1W3H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W3H-query.scw PDB file : Tito_Scwrl_1W3H.pdb: