Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKTFVKKAMLTTAAMTSAALLTFGPDAASAKTPVDNTAVQLQHQASTNEDLNTFIDILNQCIYEQDGVYYFDSEKAVELGMTKEEAQVIATLWESTSEFFSIVSQCVYLEDGNYKFDTEKAVELGFTEKEALALEQFFSAVSLKIHILQAAIVLQDDVYSYDKDAALQAGATPLQADVYEKLFSALSQEQLAAIYDMIHPQA 1NKZ Chain:B ((2-20)) --------------------------------------------------------------------------------TLTAEQSEELHKYVIDGTR--------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1NKZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 9 -763 -84.78 -40.16 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain B : 0.52 3D Compatibility (PKB) : -84.78 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.710

(partial model without unconserved sides chains): PDB file : Tito_1NKZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NKZ-query.scw PDB file : Tito_Scwrl_1NKZ.pdb: