Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE 2WJN Chain:H ((151-211)) --DVDPRGLPVVAA-DGVEAGTV--TDLWVDRSEHYFRYLELSVAG----S--ARTALIPLG-FCDVKKDKIVVT----------

General information: TITO was launched using: RESULT: Template: 2WJN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 221 -4360 -19.73 -71.48 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain H : 0.67 3D Compatibility (PKB) : -19.73 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.67 QMean score : -0.046

(partial model without unconserved sides chains): PDB file : Tito_2WJN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WJN-query.scw PDB file : Tito_Scwrl_2WJN.pdb: