Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISAD---YDVTAVGWVEYATIEVIGDVYQNPELLEGVK 2QYZ Chain:A ((64-126)) --------------------------------------------------------------KEIYEGDIIKKSN---RSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVR--NCEVIGNIYENP-------

General information: TITO was launched using: RESULT: Template: 2QYZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 210 -15094 -71.87 -251.56 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -71.87 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.383

(partial model without unconserved sides chains): PDB file : Tito_2QYZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QYZ-query.scw PDB file : Tito_Scwrl_2QYZ.pdb: