Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLVVIFGLVALFALWGVLRSVRNKNILGFLLAGATLFVFGWFTVMTVINSGYPTAH 2M0J Chain:B ((12-27)) -----------IVRLVGVIRDWANKNF------------------------------

General information: TITO was launched using: RESULT: Template: 2M0J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 11 -841 -76.45 -52.56 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain B : 0.42 3D Compatibility (PKB) : -76.45 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.42 QMean score : 0.788

(partial model without unconserved sides chains): PDB file : Tito_2M0J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2M0J-query.scw PDB file : Tito_Scwrl_2M0J.pdb: