Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALSPEIEFEDIEDDSEVIETSQTYKIDFENGRITNEIITGLEAIKQFVYLSLHTERYAYSVYSHDIGNELQDVLADNETTDAYKKMEIPRLIEEALIYDDRISA--VTDFEIEKQGESFRVSFTVETDEGTLEIEEVLGEDV 3WT4 Chain:A ((133-216)) ------------------------------NGKLESRLVDFRKAIAVIPNLAIHLNRAANEGWPINAQNELPPIIAQLAPGEA---ADFRLLLDEQLLREHGITADVVLDYEL------------------------------

General information: TITO was launched using: RESULT: Template: 3WT4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 133 -8129 -61.12 -104.21 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -61.12 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.052

(partial model without unconserved sides chains): PDB file : Tito_3WT4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WT4-query.scw PDB file : Tito_Scwrl_3WT4.pdb: