Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI 3WWV Chain:A ((5-67)) --------------------------------------------------------------------------------------------------------TGKEEMIGLIGTVVEELNP--EGMIKVR----GELWKARSKFNGKIEKGEKVRVVDMDGLTLIVVRERK-

General information: TITO was launched using: RESULT: Template: 3WWV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 287 -28029 -97.66 -444.90 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.41 3D Compatibility (PKB) : -97.66 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.41 QMean score : 0.547

(partial model without unconserved sides chains): PDB file : Tito_3WWV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3WWV-query.scw PDB file : Tito_Scwrl_3WWV.pdb: