Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFL---VVIGIIIWNVIQGIKVLRAA 1M6I Chain:A ((441-469)) --------------------------------------------------------------------------------GKGVIFYLRDKVVVGIVLWNIFNRMPIAR--

General information: TITO was launched using: RESULT: Template: 1M6I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 41 -13097 -319.43 -503.71 target 2D structure prediction score : 0.04 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : -319.43 2D Compatibility (Sec. Struct. Predict.) : 0.04 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.793

(partial model without unconserved sides chains): PDB file : Tito_1M6I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M6I-query.scw PDB file : Tito_Scwrl_1M6I.pdb: