Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMNWRALSQTKQDRIWSEVNKIIKWKPGSRCHHIIPPDPYRVFDISSAMSSKAGHNDVSGVLSDLETSILKAFQLGTGKNDVMYALDWQHDGYTFSPHQAMPKDEFGEWPVPVFPNGDYYFFFHQDFSWGLLGDPWKCAITVFGEELLEAIDNDPPILFRNK 1CHM Chain:B ((91-116)) ----------------------------------------------------------------------------VGTDNIVYT-DWQRDNYFAAIQQALPK-----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1CHM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 27 -1874 -69.39 -72.06 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain B : 0.55 3D Compatibility (PKB) : -69.39 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.185

(partial model without unconserved sides chains): PDB file : Tito_1CHM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1CHM-query.scw PDB file : Tito_Scwrl_1CHM.pdb: