Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA
1LRY Chain:A ((1-165))-AILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQ--


General information:
TITO was launched using:
RESULT:

Template: 1LRY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -75946 for 1277 contacts (-59.5/contact) +
2D Compatibility (PS) -17580 + (NN) -2688 + (LL) 472
1D Compatibility (HY) -23600 + (ID) 8250
Total energy: -127592.0 ( -99.92 by residue)
QMean score : 0.725

(partial model without unconserved sides chains):
PDB file : Tito_1LRY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1LRY-query.scw
PDB file : Tito_Scwrl_1LRY.pdb: