Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceQAPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPLPNCG
M040 Chain:A ((5-101))QAPPPPQCDPGLLSPCAAPIFFGTAPSASCCSSLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPLPNCG


General information:
TITO was launched using:
RESULT:

Template: M040.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -966 for 479 contacts (-2.0/contact) +
2D Compatibility (PS) -7050 + (NN) -6250 + (LL) 0
1D Compatibility (HY) 2400 + (ID) 200
Total energy: -12066.0 ( -25.19 by residue)
QMean score : -0.054

(partial model without unconserved sides chains):
PDB file : Tito_M040.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M040-query.scw
PDB file : Tito_Scwrl_M040.pdb: