Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK
3NBA Chain:D ((24-176))-----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-


General information:
TITO was launched using:
RESULT:

Template: 3NBA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -103887 for 1161 contacts (-89.5/contact) +
2D Compatibility (PS) -16648 + (NN) -7956 + (LL) 212
1D Compatibility (HY) -17200 + (ID) 3900
Total energy: -149379.0 ( -128.66 by residue)
QMean score : 0.533

(partial model without unconserved sides chains):
PDB file : Tito_3NBA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3NBA-query.scw
PDB file : Tito_Scwrl_3NBA.pdb: