Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSIELRTKYGQIDISNEVIAMVAGGAAVDCYGIVGMASKNQIKDGLTEILRKENFSRGVQVRQEGEQIHIDMYIIVSYGTKISEVAHNVQTKVKYTVNQTI-GLAVDSVNIYVQGVRVTNP 3W61 Chain:A ((10-80)) ---------------------RIVEAAERVPGVRGVIHL--------------------RARYVGQDIWADMIIGVDPENTVEQ-AHEICEAVQAAVCGKIRRI--ESLAVSAEA------

General information: TITO was launched using: RESULT: Template: 3W61.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 292 -65400 -223.97 -934.29 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -223.97 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.333

(partial model without unconserved sides chains): PDB file : Tito_3W61.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3W61-query.scw PDB file : Tito_Scwrl_3W61.pdb: