Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKDVSKNQEENISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD 4GCZ Chain:A ((262-321)) ------------------------------------------------------------------------------------------------------VLADRVQIQQVLVNLFRNALEAMAQSQRRELVVTNTP-AADDMIEVEVSDTGSGFQDDVIP-----------------------------

General information: TITO was launched using: RESULT: Template: 4GCZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 115 -16430 -142.87 -273.83 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -142.87 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.615

(partial model without unconserved sides chains): PDB file : Tito_4GCZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GCZ-query.scw PDB file : Tito_Scwrl_4GCZ.pdb: