Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK 5FMF Chain:S ((126-189)) --------------SKLLWATEYIQKKGKPVLVNELLDYLS----MKK------DDKVIELLKKLDRIEFD-KGTFKYLSTYDVHSP--------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5FMF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 186 -20727 -111.43 -334.30 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain S : 0.71 3D Compatibility (PKB) : -111.43 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.529

(partial model without unconserved sides chains): PDB file : Tito_5FMF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FMF-query.scw PDB file : Tito_Scwrl_5FMF.pdb: