Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceACEVGQLTVCMPAITTGAKPSGACCGNLRAQQACFCQYAKDPSLARYITSPHARETLVSCGLAVPHC
M041 Chain:A ((1-167))ACEVGQLTVCMPAITTGAKPSGACCGNLRAQQACFCQYAKDPSLARYITSPHARETLVSCGLAVPHC


General information:
TITO was launched using:
RESULT:

Template: M041.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -46660 for 454 contacts (-102.8/contact) +
2D Compatibility (PS) -6615 + (NN) -17 + (LL) 0
1D Compatibility (HY) -9200 + (ID) 3350
Total energy: -65842.0 ( -145.03 by residue)
QMean score : 0.586

(partial model without unconserved sides chains):
PDB file : Tito_M041.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M041-query.scw
PDB file : Tito_Scwrl_M041.pdb: