Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceESAISCGTVTSDLTPCVGYLTSGKGKPTPNCCGGVKKLAGLANTTPARRAVCGCLKQAYSQFPNANSAAVSGLPGACGVNLPFKISLQTNCNTIN
M041 Chain:A ((1-116))ESAISCGTVTSDLTPCVGYLTSGKGKPTPNCCGGVKKLAGLANTTPARRAVCGCLKQAYSQFPNANSAAVSGLPGACGVNLPFKISLQTNCNTIN


General information:
TITO was launched using:
RESULT:

Template: M041.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -74418 for 692 contacts (-107.5/contact) +
2D Compatibility (PS) -9659 + (NN) -2059 + (LL) 0
1D Compatibility (HY) -11600 + (ID) 4750
Total energy: -102486.0 ( -148.10 by residue)
QMean score : 0.582

(partial model without unconserved sides chains):
PDB file : Tito_M041.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M041-query.scw
PDB file : Tito_Scwrl_M041.pdb: