Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------MDKLTKEELIFLVKELMNPTL--DDEKVSEYLDLLEKNVPYPAPSDLIFWSNE--DYTAEQVVKIALNYKDE--------- 1UNK Chain:A ((1-87)) MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG

General information: TITO was launched using: RESULT: Template: 1UNK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 198 -33637 -169.88 -494.65 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -169.88 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.702

(partial model without unconserved sides chains): PDB file : Tito_1UNK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UNK-query.scw PDB file : Tito_Scwrl_1UNK.pdb: