Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----MKLDEFTIGQVFK-TKSLKVSKDDIMRFAGEF-DPQYMHVDEEKASKGRF-NGIIASGIQTLAISFKLWIEEGFYGDDIIAGTEMNHMTFIKPVYPDDELFTIVEVLDKQPKRNE----LGILTVLL-STYNQKEVKVFEGELSV-LIKR----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2BI0 Chain:A ((8-337))IRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVGNRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTL---ATQRVKANLFYRGLRFHRFPAVGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWKPGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSGAPELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTAPVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF


General information:
TITO was launched using:
RESULT:

Template: 2BI0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 625 -58662 -93.86 -425.09
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : -93.86
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.315

(partial model without unconserved sides chains):
PDB file : Tito_2BI0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2BI0-query.scw
PDB file : Tito_Scwrl_2BI0.pdb: