Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN
M042 Chain:A ((1-93))AISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN


General information:
TITO was launched using:
RESULT:

Template: M042.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -66748 for 708 contacts (-94.3/contact) +
2D Compatibility (PS) -9615 + (NN) -2740 + (LL) 0
1D Compatibility (HY) -10400 + (ID) 4600
Total energy: -94103.0 ( -132.91 by residue)
QMean score : 0.540

(partial model without unconserved sides chains):
PDB file : Tito_M042.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M042-query.scw
PDB file : Tito_Scwrl_M042.pdb: