Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAITCGQVSSAIAPCLSYARGMGSAPSAGCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR
M042 Chain:A ((1-157))AITCGQVSSAIAPCLSYARGMGSAPSAGCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR


General information:
TITO was launched using:
RESULT:

Template: M042.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -56009 for 633 contacts (-88.5/contact) +
2D Compatibility (PS) -9523 + (NN) -1976 + (LL) 0
1D Compatibility (HY) -9600 + (ID) 4550
Total energy: -81658.0 ( -129.00 by residue)
QMean score : 0.628

(partial model without unconserved sides chains):
PDB file : Tito_M042.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M042-query.scw
PDB file : Tito_Scwrl_M042.pdb: