Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSE-NEQF-SQMEAKARARMKERGVEVSDIAELVFFLQKKYHPDLTIDECTLNVNRVLAKREVQNAILTGIELDVLAEQKKLSEPLQTMLEIDESLYGVDEVLAFSIVNIYGSIGFTNYGYIDKEKPGILKRLNDKSTGECHTFLDDIVGAISAAASSRLAHRARHTE
1RFZ Chain:A ((1-164))SNAMSEFIMNNLEQTARRWLEERGVTVEKIAELVYYLQSKYHPDLTMEECIENVNRVISKREVQNAILTGIQLDKLAEDGRLDEPLQSIIRRDEGLYGVDEILALSIVNVYGSIGFTNYGYIDKQKPGILQYLNDKSTGKCNTFLDDIVGAIAAAASSRLAHRA----


General information:
TITO was launched using:
RESULT:

Template: 1RFZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 752 28564 37.98 176.32
target 2D structure prediction score : 0.67
Monomeric hydrophicity matching model chain A : 0.91

3D Compatibility (PKB) : 37.98
2D Compatibility (Sec. Struct. Predict.) : 0.67
1D Compatibility (Hydrophobicity) : 0.91
QMean score : 0.515

(partial model without unconserved sides chains):
PDB file : Tito_1RFZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1RFZ-query.scw
PDB file : Tito_Scwrl_1RFZ.pdb: