Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIVSKKIGEKLGFDWTIFFEDVCNET-KHNSKDSA 4IA8 Chain:B ((16-82)) -----IKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD-----

General information: TITO was launched using: RESULT: Template: 4IA8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 199 -18752 -94.23 -284.12 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain B : 0.75 3D Compatibility (PKB) : -94.23 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.395

(partial model without unconserved sides chains): PDB file : Tito_4IA8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IA8-query.scw PDB file : Tito_Scwrl_4IA8.pdb: