Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)
Input alignment information:
| Query sequence | -MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHEKENTIVL |
| 3PLX Chain:A ((3-27)) | AMNITLLKSKIHRASVTEARLDYIG------------------------------------------------------------------------------------------------------- |
|
General information:
TITO was launched using:
| RESULT:
|
Template: 3PLX.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
|
3D Compatibility (PKB) 306 for 55 contacts (5.6/contact) +
2D Compatibility (PS) -2509 + (NN) 1234 + (LL) 8108
1D Compatibility (HY) -2800 + (ID) 650
Total energy: 3689.0 ( 67.07 by residue)
QMean score : 0.125
|
|
|