Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------MLQLNGKDVKWKKDTGTIQDLLASYQL-----ENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGGG 1EUV Chain:B ((20-98)) PETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

General information: TITO was launched using: RESULT: Template: 1EUV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 219 -25505 -116.46 -386.43 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain B : 0.72 3D Compatibility (PKB) : -116.46 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.398

(partial model without unconserved sides chains): PDB file : Tito_1EUV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EUV-query.scw PDB file : Tito_Scwrl_1EUV.pdb: