Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKDVSKNQEENISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEITSHECLIEIGLD 4U7O Chain:A ((150-212)) ------------------------------------------------------------------------------------------------------VEIDTDKFTQVLDNIMNNAIKYSPDG--GVVTCRLLET--HNQVIISISDQGLGIPRADLGH----------------------------

General information: TITO was launched using: RESULT: Template: 4U7O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 109 -22849 -209.62 -393.95 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -209.62 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.515

(partial model without unconserved sides chains): PDB file : Tito_4U7O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U7O-query.scw PDB file : Tito_Scwrl_4U7O.pdb: