Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRIGHGYDVHRFGEGDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLGVAVDQVNVKATTTERLGFTGREEGIAVHAVALLMAR
2AMT Chain:E ((1-155))MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI--


General information:
TITO was launched using:
RESULT:

Template: 2AMT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -122886 for 1305 contacts (-94.2/contact) +
2D Compatibility (PS) -17148 + (NN) -11797 + (LL) 244
1D Compatibility (HY) -17200 + (ID) 5550
Total energy: -174337.0 ( -133.59 by residue)
QMean score : 0.503

(partial model without unconserved sides chains):
PDB file : Tito_2AMT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2AMT-query.scw
PDB file : Tito_Scwrl_2AMT.pdb: