Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK
M044 Chain:A ((1-93))AISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK


General information:
TITO was launched using:
RESULT:

Template: M044.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -68959 for 675 contacts (-102.2/contact) +
2D Compatibility (PS) -9331 + (NN) -831 + (LL) 0
1D Compatibility (HY) -11600 + (ID) 4600
Total energy: -95321.0 ( -141.22 by residue)
QMean score : 0.526

(partial model without unconserved sides chains):
PDB file : Tito_M044.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M044-query.scw
PDB file : Tito_Scwrl_M044.pdb: