Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------MDKLTKEELIFL-------VKELMNPT-LDDEKVSEYLDLLEKN--VPYPAPSDLIFWSNEDYTAEQVVKIALNYKDE- 1SMT Chain:A ((24-121)) ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC

General information: TITO was launched using: RESULT: Template: 1SMT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 157 -27591 -175.74 -405.75 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -175.74 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.495

(partial model without unconserved sides chains): PDB file : Tito_1SMT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SMT-query.scw PDB file : Tito_Scwrl_1SMT.pdb: