Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAITQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYLRNKDVTRYRELINKLGLRR 4A5U Chain:B ((1-88)) -SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHF--------SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

General information: TITO was launched using: RESULT: Template: 4A5U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 228 -25570 -112.15 -319.62 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain B : 0.90 3D Compatibility (PKB) : -112.15 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.90 QMean score : 0.741

(partial model without unconserved sides chains): PDB file : Tito_4A5U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4A5U-query.scw PDB file : Tito_Scwrl_4A5U.pdb: