Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------MTLWVGILVGVVALLIGVALGFFI---------ARKYMMSYLKKN--PPINEQMLRMMMMQMGMK----PSQKKINQMMKAMNNQTK------ 4WYH Chain:A ((31-129)) DYSWIEKVLEMGLQDSRKRFILYVASRYLVNVKGVNEDEALQTLKEFYYKLQSGKVYESWLKSVINGVKKKGLLPWSLKRIEERDKEMYNEIIRVLKNS

General information: TITO was launched using: RESULT: Template: 4WYH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 234 -5540 -23.67 -76.94 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -23.67 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.310

(partial model without unconserved sides chains): PDB file : Tito_4WYH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WYH-query.scw PDB file : Tito_Scwrl_4WYH.pdb: