Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceGPYCRDVVETILPCIEYITTPGASTLPAPCCNGMKSLNGEPQYVCRCLKETFFVLPGLNLAALAALPKNCGVNLPYQITPDMNCDKVN
M045 Chain:A ((1-99))GPYCRDVVETILPCIEYITTPGASTLPAPCCNGMKSLNGEPQYVCRCLKETFFVLPGLNLAALAALPKNCGVNLPYQITPDMNCDKVN


General information:
TITO was launched using:
RESULT:

Template: M045.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -77254 for 613 contacts (-126.0/contact) +
2D Compatibility (PS) -9361 + (NN) -6994 + (LL) 0
1D Compatibility (HY) -14400 + (ID) 4400
Total energy: -112409.0 ( -183.38 by residue)
QMean score : 0.709

(partial model without unconserved sides chains):
PDB file : Tito_M045.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M045-query.scw
PDB file : Tito_Scwrl_M045.pdb: