Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPKIGVSLIVLIMLIIFLAGCNKNEQNGDETKMQSLVGYVVLKDNE-RAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL 2QCP Chain:X ((6-66)) -------------------------------QVISATGVVKGIDLESKKITIHHDPIA----------AV-NW-PEMTMRFTITPQTKMSEIKTGDKVAFNFVQ-----------------

General information: TITO was launched using: RESULT: Template: 2QCP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 208 5159 24.80 85.98 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain X : 0.58 3D Compatibility (PKB) : 24.80 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.732

(partial model without unconserved sides chains): PDB file : Tito_2QCP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QCP-query.scw PDB file : Tito_Scwrl_2QCP.pdb: