Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------------------------------------------------------------------------------------------------------------------MSTLPPCPQCNS-----EYTYEDGALLVCPECAHEWS-PNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKV--------------
2FIY Chain:A ((19-308))PHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDPERLRKSREHGMPPLAYDLLVREGAWLPWLDALLAGYPAPANAAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPFLGAALQVAWSHWLLGLEEGAVVETESRTLCPACGSPPMAGMIRQTGLRYLSCSLCACEWHYVRIKCSHCEESKHLAYLSLEHGQPAEK-------AVLRAETCPSCQGYLKQFYL-EFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAPGG


General information:
TITO was launched using:
RESULT:

Template: 2FIY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 21505 for 674 contacts (31.9/contact) +
2D Compatibility (PS) -11001 + (NN) -2668 + (LL) 1008
1D Compatibility (HY) -1600 + (ID) 950
Total energy: 6294.0 ( 9.34 by residue)
QMean score : 0.236

(partial model without unconserved sides chains):
PDB file : Tito_2FIY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2FIY-query.scw
PDB file : Tito_Scwrl_2FIY.pdb: