Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----MFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTVMIPTSKILSSNIRPVTDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGAEVVRDLMRMKKEKALNASEKKMLDNAYEFLISELEVIKGITEKQIKSFG 2LQK Chain:A ((1-70)) AGHMKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEE----------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2LQK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -30659 -148.83 -471.68 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -148.83 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.354

(partial model without unconserved sides chains): PDB file : Tito_2LQK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LQK-query.scw PDB file : Tito_Scwrl_2LQK.pdb: