Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----MIDGVKVKKLMKHSDDRGFFAE-LVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQ-DDLWFFPTGHAQVVLYDLREDSKTKGETDVYYMG-EDNPMLLLIPKGVAHGYRVLGETPLTIIYFTTMSYNPDQPDEKRIPWDDETIGFNWNTEFR---
3EJK Chain:A ((15-171))AILLPVEGAQLSELRQIPAEGGPVLHML-RLDSPQFSQFGEIYFSEVLPRRVKAWKRH-SLMTQLFAVPVGCIHVVLYDGREKSPTSGRLAQVTLGRPDNYRLLRIPPQVWYGFAATGDTPALVANCTDIPHRQGE--SERAPQDAPFIPFSWAGADLSGT


General information:
TITO was launched using:
RESULT:

Template: 3EJK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 754 41353 54.84 281.31
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain A : 0.70

3D Compatibility (PKB) : 54.84
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.70
QMean score : 0.529

(partial model without unconserved sides chains):
PDB file : Tito_3EJK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3EJK-query.scw
PDB file : Tito_Scwrl_3EJK.pdb: