Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQLCVALDLEKKEDNLSLLQELKGLDLWAKVGLRSFIRDGATFLDEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLDIDMLTVHLSSAKSALTILMQRLNALKK----RPLIMGVSALTSFSEEEFLMVYNAPLKTQAITLSAIGKESGIDGVVCSVFESLAIKEALGKGFLTLTPGIRLDKNDKEDQERVANAKEAKQNLSDFIVVGRPIYQAKEPREVVLELLKDC
3LDV Chain:A ((28-254))PKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHK--RGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGIL--SAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL


General information:
TITO was launched using:
RESULT:

Template: 3LDV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -136475 for 1794 contacts (-76.1/contact) +
2D Compatibility (PS) -24269 + (NN) -10380 + (LL) 140
1D Compatibility (HY) -12800 + (ID) 3450
Total energy: -187234.0 ( -104.37 by residue)
QMean score : 0.548

(partial model without unconserved sides chains):
PDB file : Tito_3LDV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3LDV-query.scw
PDB file : Tito_Scwrl_3LDV.pdb: