Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELK
4BPF Chain:A ((1-77))MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDAFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSEL-


General information:
TITO was launched using:
RESULT:

Template: 4BPF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 275 17118 62.25 225.24
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain A : 1.00

3D Compatibility (PKB) : 62.25
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 1.00
QMean score : 0.122

(partial model without unconserved sides chains):
PDB file : Tito_4BPF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4BPF-query.scw
PDB file : Tito_Scwrl_4BPF.pdb: