Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
2BEF Chain:C ((9-138))--ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-ASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWF---


General information:
TITO was launched using:
RESULT:

Template: 2BEF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -78766 for 1005 contacts (-78.4/contact) +
2D Compatibility (PS) -13942 + (NN) -5008 + (LL) 212
1D Compatibility (HY) -12400 + (ID) 3550
Total energy: -113454.0 ( -112.89 by residue)
QMean score : 0.563

(partial model without unconserved sides chains):
PDB file : Tito_2BEF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2BEF-query.scw
PDB file : Tito_Scwrl_2BEF.pdb: