Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNGNKDAIFKALGDSTRRLILDELSERNELTLYELTIRLITKYDLSITRQAIAKHLSVLEDAGLVTSKRKGKYRVLIFNNEPLKNLLKGWIE 2JSC Chain:A ((11-86)) ----LARLGRALADPTRCRILVALLD-GVCYPGQLAAH------LGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARAL-----

General information: TITO was launched using: RESULT: Template: 2JSC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 -54940 -201.24 -722.89 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -201.24 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.641

(partial model without unconserved sides chains): PDB file : Tito_2JSC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JSC-query.scw PDB file : Tito_Scwrl_2JSC.pdb: