Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK 4CR2 Chain:X ((23-52)) ------------LCTPIPVQGEIEIKPNEEE---ELGFWDFEWRP-

General information: TITO was launched using: RESULT: Template: 4CR2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 40 -1075 -26.86 -35.82 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain X : 0.62 3D Compatibility (PKB) : -26.86 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.425

(partial model without unconserved sides chains): PDB file : Tito_4CR2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4CR2-query.scw PDB file : Tito_Scwrl_4CR2.pdb: